DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11444 and pdap1

DIOPT Version :9

Sequence 1:NP_001284863.1 Gene:CG11444 / 31388 FlyBaseID:FBgn0029715 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001107539.1 Gene:pdap1 / 100135404 XenbaseID:XB-GENE-6257964 Length:179 Species:Xenopus tropicalis


Alignment Length:207 Identity:81/207 - (39%)
Similarity:121/207 - (58%) Gaps:45/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPR-GKFVNHKGRSRHFTSPEELQQESEEDSDQTSGSGSDSDDKDAAGGKASSSASKAKAPATRK 64
            ||: ||...||||.|.:|||||:..:.:.:::                                |
 Frog     1 MPKGGKKGGHKGRVRQYTSPEEIDAQIKAENE--------------------------------K 33

  Fly    65 APVNRNQKSRSAAGAGAASSSESESGEDSDDDSEAEARDAKKGVASLIEIENPNRVTKKATQKLS 129
            |.....::||..|....:...:.:|.::||:|.:.:.:  :|||..||:|||||| ..::::|::
 Frog    34 AQEAEYEESRGGAAGLPSKDKQDQSSDESDEDEDYQQK--RKGVEGLIDIENPNR-NAQSSKKVT 95

  Fly   130 AIKLDDGPAGAGGNPKPELSRREREQIEKQRARQRYEKLHAAGKTTEAKADLARLALIRQQREEA 194
            .::: :||.        ||||||||:||||:|::||.|:|.||||.:|||||||||:||:|||||
 Frog    96 QLEI-EGPR--------ELSRREREEIEKQKAKERYMKMHLAGKTDQAKADLARLAIIRKQREEA 151

  Fly   195 AAKREAEKKAAD 206
            |.|:|.|||..|
 Frog   152 AKKKEEEKKFKD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11444NP_001284863.1 PP28 115..190 CDD:287254 40/74 (54%)
pdap1NP_001107539.1 PP28 83..148 CDD:370922 39/74 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7489
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4746
OMA 1 1.010 - - QHG60099
OrthoDB 1 1.010 - - D1572985at2759
OrthoFinder 1 1.000 - - FOG0004630
OrthoInspector 1 1.000 - - otm47798
Panther 1 1.100 - - LDO PTHR22055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.