DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3527 and emg1

DIOPT Version :9

Sequence 1:NP_572170.1 Gene:CG3527 / 31387 FlyBaseID:FBgn0029714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001035427.1 Gene:emg1 / 678588 ZFINID:ZDB-GENE-060421-2909 Length:238 Species:Danio rerio


Alignment Length:224 Identity:144/224 - (64%)
Similarity:168/224 - (75%) Gaps:8/224 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KQFKVLHLNATEKRLIIVLEGAQLETVKVHNTFELLNCDDHAGIMRKNQRDPGSCRPDITHQCLL 93
            ||.:.||...|||||::|||||.||||||..||||||||.|..::.|:.||||..||||.|||||
Zfish    23 KQQRSLHDQMTEKRLVVVLEGATLETVKVGKTFELLNCDQHKSMIIKSGRDPGKIRPDIAHQCLL 87

  Fly    94 MLFDSPLNRAGLLQVFVRTEHNVLIEINPQTRIPRTFKRFAGLMVQLLHKFQIRANDSSRRLMSV 158
            ||.||||||||||||::.||.||||||||||||||||.||.|||||||||..:||.|..:||:.:
Zfish    88 MLLDSPLNRAGLLQVYIHTEKNVLIEINPQTRIPRTFARFCGLMVQLLHKLSVRAADGPQRLLRL 152

  Fly   159 IKNPITDHVPVGCKKYAMSFSGKLLPNCRDLVPHGDETSASYDEPVVIVIGAFAHGVLKTDYTEE 223
            ||||::||:|.||.:::.||........|.:||.        |.|..|||||||||.:..||||:
Zfish   153 IKNPVSDHLPPGCPRFSTSFKAGDAVCPRTIVPD--------DGPAAIVIGAFAHGAVNVDYTEK 209

  Fly   224 LFSISNYPLSAAIACSKICSAFEEVWGVV 252
            ..||||||||||:||:||||||||||||:
Zfish   210 TVSISNYPLSAALACAKICSAFEEVWGVL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3527NP_572170.1 EMG1 45..245 CDD:281572 127/199 (64%)
emg1NP_001035427.1 EMG1 39..231 CDD:281572 127/199 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592128
Domainoid 1 1.000 263 1.000 Domainoid score I1893
eggNOG 1 0.900 - - E1_COG1756
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4617
Inparanoid 1 1.050 290 1.000 Inparanoid score I2795
OMA 1 1.010 - - QHG56324
OrthoDB 1 1.010 - - D1266231at2759
OrthoFinder 1 1.000 - - FOG0005090
OrthoInspector 1 1.000 - - oto41464
orthoMCL 1 0.900 - - OOG6_101493
Panther 1 1.100 - - LDO PTHR12636
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R744
SonicParanoid 1 1.000 - - X3612
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.