DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3527 and mra1

DIOPT Version :9

Sequence 1:NP_572170.1 Gene:CG3527 / 31387 FlyBaseID:FBgn0029714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_593671.1 Gene:mra1 / 2542139 PomBaseID:SPAC18G6.07c Length:359 Species:Schizosaccharomyces pombe


Alignment Length:222 Identity:110/222 - (49%)
Similarity:145/222 - (65%) Gaps:12/222 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NATEKRLIIVLEGAQLETVKVHNT----FELLNCDDHAGIMRKNQRDPGSCRPDITHQCLLMLFD 97
            :.|.:|||:||:.|.||..||...    ::|||||||.||::|..|:....||||||||||.|.|
pombe   144 DTTTQRLIVVLDQACLEIYKVGKAKDAKYQLLNCDDHQGILKKLNRNIAQARPDITHQCLLTLLD 208

  Fly    98 SPLNRAGLLQVFVRTEHNVLIEINPQTRIPRTFKRFAGLMVQLLHKFQIRANDSSRRLMSVIKNP 162
            ||||:||.|||::.|...||||:||..|||||||||:|||||||||..||:.:.:.:|:.|||||
pombe   209 SPLNKAGRLQVYIHTAKKVLIEVNPSVRIPRTFKRFSGLMVQLLHKLSIRSVNGNEKLLKVIKNP 273

  Fly   163 ITDHVPVGCKKYAMSFSGKLLPNCRDLVPHGDETSASYDEPVVIVIGAFAHGV--LKTDYTEELF 225
            :||::|..|:|..:||....:|      |.....:...::.|.|.|||.|||.  ....:.:|..
pombe   274 VTDYLPPNCRKATLSFDAPTVP------PRKYLETLQPNQSVCIAIGAMAHGPDDFSDGWVDEKI 332

  Fly   226 SISNYPLSAAIACSKICSAFEEVWGVV 252
            |||:|||||:|||||...:.|:..|:|
pombe   333 SISDYPLSASIACSKFLHSMEDFLGIV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3527NP_572170.1 EMG1 45..245 CDD:281572 103/205 (50%)
mra1NP_593671.1 EMG1 152..352 CDD:281572 103/205 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 197 1.000 Domainoid score I685
eggNOG 1 0.900 - - E1_COG1756
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4617
Inparanoid 1 1.050 209 1.000 Inparanoid score I959
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005090
OrthoInspector 1 1.000 - - oto101177
orthoMCL 1 0.900 - - OOG6_101493
Panther 1 1.100 - - LDO PTHR12636
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R744
SonicParanoid 1 1.000 - - X3612
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.