DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11436 and TTC17

DIOPT Version :9

Sequence 1:NP_572169.1 Gene:CG11436 / 31386 FlyBaseID:FBgn0029713 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001363454.1 Gene:TTC17 / 55761 HGNCID:25596 Length:1198 Species:Homo sapiens


Alignment Length:594 Identity:122/594 - (20%)
Similarity:221/594 - (37%) Gaps:176/594 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAFAVLL-----GLFHLIQACNHWVLREE-QIVPKLDSPFHMREPHNLAAFLKQIRYSEYVERSY 64
            |:.:.||     |.|    |..|||:.|: :|..::|||.:::.||:|...::|.....|::...
Human    23 LSLSALLSVAARGAF----ATTHWVVTEDGKIQQQVDSPMNLKHPHDLVILMRQEATVNYLKELE 83

  Fly    65 LDLLRKREQIVEH------------------LRFSMRFGE-DLAEQAKCAMDYYMLEKRMSYLKI 110
            ..|:.::..|.|:                  ::..:..|: ||.:..     |..||.:    .|
Human    84 KQLVAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKVPLGDLDLYDGT-----YITLESK----DI 139

  Fly   111 TPEQLKRINL-----PDQRQLHIQKSASSMGMEPICSDYHRLSVGPATYDHLESFRPEV-LAAAF 169
            :||..  |:.     ||..|             |.|:....|......:.||...:..| |:|..
Human   140 SPEDY--IDTESPVPPDPEQ-------------PDCTKILELPYSIHAFQHLRGVQERVNLSAPL 189

  Fly   170 LEREHDTNVGMA-----TVELTRRFAVDGLQHHPASWKFHTLSSYYWRMRGNAREALPCARLAAL 229
            |.:|......::     :::.......:|||.:.:||..:.::|:|||::....:.:.||..|..
Human   190 LPKEDPIFTYLSKRLGRSIDDIGHLIHEGLQKNTSSWVLYNMASFYWRIKNEPYQVVECAMRALH 254

  Fly   230 LAPPIFKDIPLLSLGTILFRMGRLADADLILTAAVEHAPNVAENHVVLASALAMKHDFNRSLQHF 294
            .:....|||.|::|..:|.|....|||.:::.||::.: :...::..|.:..||..::|.|:..:
Human   255 FSSRHNKDIALVNLANVLHRAHFSADAAVVVHAALDDS-DFFTSYYTLGNIYAMLGEYNHSVLCY 318

  Fly   295 DEAERLDPSTLPRTQQVRNFISCLENLTKKTSKMYSYVKYMQNEVKEFKKL------------KH 347
            |.|.:..|. ..:..:.::.:.|.:.|.:|....:..::...||:||::|.            ||
Human   319 DHALQARPG-FEQAIKRKHAVLCQQKLEQKLEAQHRSLQRTLNELKEYQKQHDHYLRQQEILEKH 382

  Fly   348 HISQ---------------------NHE--RLIQQQLPL-------------------------- 363
            .:.|                     ||:  ||:.||..|                          
Human   383 KLIQEEQILRNIIHETQMAKEAQLGNHQICRLVNQQHSLHCQWDQPVRYHRGDIFENVDYVQFGE 447

  Fly   364 ----GARRLLGLDAKTNNDDL-----------------------HRRGQY--------CS---TR 390
                .:...:..|.::|..|:                       :|..|:        |:   .|
Human   448 DSSTSSMMSVNFDVQSNQSDINDSVKSSPVAHSILWIWGRDSDAYRDKQHILWPKRADCTESYPR 512

  Fly   391 TPNGSDEPVLFCDFYSDMQMRLESKDVDIDVLER-DLKANTDAVIRQVS-TEIRKQFNLEQL-KA 452
            .|.|.:.|..|        :..|:|.:.|..|.. |.....:|.....| |:.||...|..| |.
Human   513 VPVGGELPTYF--------LPPENKGLRIHELSSDDYSTEEEAQTPDCSITDFRKSHTLSYLVKE 569

  Fly   453 AKAQMPAKA 461
            .:.:|..||
Human   570 LEVRMDLKA 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11436NP_572169.1 TPR_11 240..302 CDD:290150 16/61 (26%)
TPR repeat 240..265 CDD:276809 9/24 (38%)
TPR repeat 270..300 CDD:276809 7/29 (24%)
TTC17NP_001363454.1 TPR_1 297..328 CDD:366144 8/31 (26%)
GBP_C <329..410 CDD:389220 12/80 (15%)
coiled coil 379..390 CDD:293879 3/10 (30%)
coiled coil 399..410 CDD:293879 1/10 (10%)
TPR <563..718 CDD:223533 6/16 (38%)
TPR repeat 621..647 CDD:276809
TPR repeat 652..684 CDD:276809
TPR repeat 689..717 CDD:276809
TPR <1036..1193 CDD:223533
TPR repeat 1073..1100 CDD:276809
TPR repeat 1105..1137 CDD:276809
TPR repeat 1142..1170 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159771
Domainoid 1 1.000 67 1.000 Domainoid score I9889
eggNOG 1 0.900 - - E1_KOG4507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006900
OrthoInspector 1 1.000 - - oto90601
orthoMCL 1 0.900 - - OOG6_107764
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5852
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.670

Return to query results.
Submit another query.