DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and PHM8

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_010954.1 Gene:PHM8 / 856759 SGDID:S000000839 Length:321 Species:Saccharomyces cerevisiae


Alignment Length:268 Identity:48/268 - (17%)
Similarity:91/268 - (33%) Gaps:94/268 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FDVTDTLLRLEDPLRQYHQTA------EEFGVTGVDRRRLEQCFRQQF----KAM--SSEHPNFG 71
            ||:.:||.|....::...|.:      .|.|....:..||.:.:.|::    |.:  :.:..:..
Yeast    57 FDIDNTLYRKSTKVQLLMQQSLSNFFKYELGFDDDEAERLIESYYQEYGLSVKGLIKNKQIDDVL 121

  Fly    72 RYS-------PGLDWQR--WWLQLVARTFSCVDHGLAPEKLEKIGQRLISVFRTSACWSHVNGAQ 127
            :|:       |..|:.:  |.|:.:          |...|.:|:|       :....|...|..:
Yeast   122 QYNTFIDDSLPLQDYLKPDWKLREL----------LINLKKKKLG-------KFDKLWLFTNSYK 169

  Fly   128 ELVQNVRNAGKCVGIISNFDSSLPQVLDAMGFAGKFDFILTSY------EAGVMKPERGIFEIPL 186
                  .:|.:||.|              :|.|..||.|...:      |..:.||:...||  .
Yeast   170 ------NHAIRCVKI--------------LGIADLFDGITYCHYDRPIEEEFICKPDPKFFE--T 212

  Fly   187 QRLQ------------------IPAEQALHIGNKL----DMDYEGARNCGWSGLLVSNADNPHSF 229
            .:||                  :.:..::.:|:.:    |..||.      ..::..:..|...|
Yeast   213 AKLQSGLSSFANAWFIDDNESNVRSALSMGMGHVIHLIEDYQYES------ENIVTKDHKNKQQF 271

  Fly   230 ASLSSLLE 237
            :.|..:||
Yeast   272 SILKDILE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 43/248 (17%)
HAD-SF-IA-v1 16..214 CDD:273686 43/243 (18%)
PHM8NP_010954.1 HAD_5NT 54..250 CDD:319791 40/231 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342025
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.