DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and GEP4

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_011968.1 Gene:GEP4 / 856500 SGDID:S000001142 Length:185 Species:Saccharomyces cerevisiae


Alignment Length:110 Identity:25/110 - (22%)
Similarity:34/110 - (30%) Gaps:46/110 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 MGFAGKFDFILTSYEAGVMKPERGIFEIP-LQRLQIPAEQALHIGNK---LDMDYEGARNC---- 213
            |..:|..:.:...|...:.||.   ..:| ...|.||    :|...|   ||.|     ||    
Yeast     1 MNISGTLNTLRLLYNPSLCKPS---LVVPTFNDLPIP----IHDSIKAVVLDKD-----NCIAFP 53

  Fly   214 -----------GW---------SGLLV------SNADNPHSFASL 232
                       .|         ..||:      ||:|..:|.|.|
Yeast    54 HDDKIWPDYLQHWETLRSKYSNKALLIVSNTAGSNSDKDYSQAKL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 17/89 (19%)
HAD-SF-IA-v1 16..214 CDD:273686 16/75 (21%)
GEP4NP_011968.1 PGP_phosphatase 3..166 CDD:286502 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.