DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and DPI35

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_013849.1 Gene:DPI35 / 855160 SGDID:S000004737 Length:302 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:68/261 - (26%)
Similarity:119/261 - (45%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VANLKRFRLVTFDVTDTLLRLEDP-LRQYHQTAEEFGVTGVDRRRLEQCFRQQFKAMSSEHPNFG 71
            |..:.|..::|||..:||...:.| :.||.....::|:. .:...|...|...||.:..::|.:|
Yeast    15 VHRVARPLIITFDAYNTLYATKLPVMEQYCIVGRKYGIK-ANPSTLTNNFPHVFKKLKEDYPQYG 78

  Fly    72 RYSPGLDWQRWWLQLVARTFSCVDHGLAPEKL--EKIGQRLISVFRTSACWSHVNGAQELVQ--- 131
            :|| |:..::||..|:...|       ||.::  |.|.:.|:......:.:.:    .:|::   
Yeast    79 KYS-GIKPEQWWSILIRNVF-------APNEIPDEMINEILMRFEGFDSYFVY----PDLIKFLK 131

  Fly   132 --NVRNAGKCVGIISNFDSSLPQVLDAMGFAGKFD-FILTSYEAGVMKPERGIFEIPLQ------ 187
              ..|:....:||:||.|....::|..:|....|. .|..|||..:.||:|.||:..|.      
Yeast   132 DLKSRHPDVILGIVSNTDPIFYKLLKNIGLFETFSGHIYLSYELNLAKPDRAIFQYALDDIISKQ 196

  Fly   188 --------RLQIPAEQALHIGNKLDMDYEGARNCGWSGLLVSNADNPHSFASLSSLLEALKTQPI 244
                    |.:| .:...|||::|..|.|||...||:|:|:...|   .:..||:.:    ::|:
Yeast   197 PHLLEKYTREEI-LQHCFHIGDELKNDLEGAEAAGWTGILLDRND---KYGFLSNSI----SKPM 253

  Fly   245 R 245
            |
Yeast   254 R 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 60/226 (27%)
HAD-SF-IA-v1 16..214 CDD:273686 57/220 (26%)
DPI35NP_013849.1 DREG-2 23..235 CDD:274056 60/225 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I2497
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I1588
Isobase 1 0.950 - 0 Normalized mean entropy S2956
OMA 1 1.010 - - QHG55252
OrthoFinder 1 1.000 - - FOG0002375
OrthoInspector 1 1.000 - - otm46700
orthoMCL 1 0.900 - - OOG6_102573
Panther 1 1.100 - - O PTHR46191
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1833
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.810

Return to query results.
Submit another query.