DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and SDT1

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_011291.1 Gene:SDT1 / 852648 SGDID:S000003192 Length:280 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:28/129 - (21%)
Similarity:52/129 - (40%) Gaps:21/129 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 QELVQNVRNAGKC--VGIISN-FDSSLPQVLDAMGFAGKFDFI----LTSYEAGVMKPERGIFEI 184
            :.::..:|.:||.  :.:.:| :.:...:.|..:|.|..||.:    .:..:..|.||....||.
Yeast   146 RNMLLRLRQSGKIDKLWLFTNAYKNHAIRCLRLLGIADLFDGLTYCDYSRTDTLVCKPHVKAFEK 210

  Fly   185 PLQRLQIPA-EQALHI---GNKLDMDYE-GARNCGWSGLLVSNADN------PHSFASLSSLLE 237
            .::...:.. |.|..|   |..::...: |.:.|..   ||.|..|      |.....:|.:||
Yeast   211 AMKESGLARYENAYFIDDSGKNIETGIKLGMKTCIH---LVENEVNEILGQTPEGAIVISDILE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 20/103 (19%)
HAD-SF-IA-v1 16..214 CDD:273686 19/98 (19%)
SDT1NP_011291.1 Pyr-5-nucltdase 56..246 CDD:273917 20/99 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342027
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.