DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and hdhd3

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001072693.1 Gene:hdhd3 / 780150 XenbaseID:XB-GENE-969463 Length:189 Species:Xenopus tropicalis


Alignment Length:153 Identity:51/153 - (33%)
Similarity:83/153 - (54%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RLVTFDVTDTLLRLEDPL-RQYHQTAEEFGVTGVDRRRLEQCFRQQFKAMSSEHPNFGRYSPGLD 78
            ||:|:|:.|||||:..|: :||...|:..|:. :|...||..||..::..|...||:| .:.|:|
 Frog     4 RLITWDIKDTLLRVRVPVGQQYFAEAKRQGLC-MDPGSLETSFRNAYRTHSRLFPNYG-LAQGMD 66

  Fly    79 WQRWWLQLVARTFSCVDHGLAPEKLEKIGQRLISVFRTSACWSHVNGAQELVQNVRNAGKCVGII 143
            .::|||.:|.:||. :......|.:..:.|:|...|.|:..|:.|.||:|.:.:.:..|..:.:|
 Frog    67 SRQWWLDVVLQTFR-LSGAEDDETVRSVAQQLYQDFSTARNWAVVPGAREALDSCKGLGLKMAVI 130

  Fly   144 SNFDSSLPQ-------VLDAMGF 159
            ||||..|.:       ..|.||:
 Frog   131 SNFDRRLEEQPMKDEPAADHMGY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 51/153 (33%)
HAD-SF-IA-v1 16..214 CDD:273686 50/152 (33%)
hdhd3NP_001072693.1 DREG-2 4..>139 CDD:274056 48/137 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11497
Inparanoid 1 1.050 135 1.000 Inparanoid score I4453
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1119971at2759
OrthoFinder 1 1.000 - - FOG0002375
OrthoInspector 1 1.000 - - mtm9462
Panther 1 1.100 - - O PTHR46191
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2471
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.