DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and nanp

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001018593.1 Gene:nanp / 553795 ZFINID:ZDB-GENE-050522-94 Length:242 Species:Danio rerio


Alignment Length:234 Identity:42/234 - (17%)
Similarity:84/234 - (35%) Gaps:57/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VTFDVTDTLL-----------RLEDPLRQYHQTAEEFGVTGVDRRRLEQCFRQQFKAMSSEHPNF 70
            :.||:.:||:           ::.:.|:..|  .:|..:..:..|.|.:..::.|      .|:.
Zfish     9 IIFDLDNTLIDTAGAGRTAIQKVCELLKSTH--VQESHIRDICERFLRKLLQESF------DPSE 65

  Fly    71 GRYSPGLDWQRWWLQLVARTFSCVDHGLAPEKLEKIGQRLISVFRTSAC---WSHVNG------- 125
            |:....:..|.|...|.....:..|..||                 |.|   |.:...       
Zfish    66 GKTIDDVRIQHWCEALQETPGTDPDPALA-----------------SRCYYTWKNTRSQALSLSS 113

  Fly   126 -----AQELVQNVRNAGKCVGIISNFDSSLP-QVLDAMGFAGKFDFILTSYEAGVMKPERGIFEI 184
                 .:||.:|.:     :.:::|.|:... :.::|:...|.|..::...:....||.|.||..
Zfish   114 EVRALLEELQKNYK-----LLLLTNGDTQTQREKIEAVRCEGLFSLVVVGGDRPEQKPARSIFTH 173

  Fly   185 PLQRLQIPAEQALHIGNKLDMDYEGARNCGWSGLLVSNA 223
            ..:...:..:..:.:|:.|..|.:|..|.|....:..||
Zfish   174 CFESAGVRPQDCIMVGDSLTTDIQGGINAGVRATVWINA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 40/228 (18%)
HAD-SF-IA-v1 16..214 CDD:273686 39/223 (17%)
nanpNP_001018593.1 CTE7 5..234 CDD:274057 42/234 (18%)
HAD_like <115..241 CDD:304363 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.