DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and CG15771

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster


Alignment Length:268 Identity:67/268 - (25%)
Similarity:109/268 - (40%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SQFVANLKRFRLVTFDVTDTLL-----------RLEDPLRQYHQTAEEFGVTGVDRRRLEQCFRQ 58
            |.|.|...:.|...||:.:||:           :|.|.|...:|.:::      |..:..|.|.:
  Fly    17 SHFDATCAKIRAFYFDLDNTLIPTRAGDSKAIRKLADFLETQYQFSKD------DATQATQNFLK 75

  Fly    59 QFKAMSSEHPNFGRYSPGLD-WQR--WWLQLVARTFSCVDHGLAPEKLEKIGQRLISVFRTSACW 120
            .|:..    |:..:.|  || |:.  |...|.||.....:. :.|:.| |:..|.::|.....  
  Fly    76 AFRRC----PDNSQTS--LDSWRTHLWRESLPARHKHLAEQ-IYPKWL-KLRYRYLAVPADYV-- 130

  Fly   121 SHVNGAQELVQNVRNAGKCVGIISNFDSSLP-QVLDAMGFAGKFDFILTSYEAGVMKPERGIFEI 184
                   :|:..:|.||..:.:|:|..|:.. :.:..:...|.||.:|.|.:....||...||..
  Fly   131 -------QLLLRMRQAGYALALITNGPSNAQWEKVAELNVRGYFDCVLVSSDLPWEKPHPEIFYA 188

  Fly   185 PLQRLQIPAEQALHIGNKLDMDYEGAR--NCG---WSGLLVSNAD---------NPHSFASLSSL 235
            ....|.:..::.:.||:||:.|.:|..  ..|   |:.|..|:|.         .||  ..|.||
  Fly   189 ACNFLNVKPQECVMIGDKLETDIKGGHLAQLGLTFWTPLSNSSAAAQSLEDVEYKPH--VKLGSL 251

  Fly   236 LEALKTQP 243
            ||..|..|
  Fly   252 LEMYKYFP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 52/223 (23%)
HAD-SF-IA-v1 16..214 CDD:273686 49/214 (23%)
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 62/254 (24%)
HAD-SF-IA-v1 31..218 CDD:273686 49/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442621
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.