DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and Nanp

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:XP_038960978.1 Gene:Nanp / 311530 RGDID:1306009 Length:261 Species:Rattus norvegicus


Alignment Length:278 Identity:56/278 - (20%)
Similarity:101/278 - (36%) Gaps:76/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LKRFRLVTFDVTDTLLRLEDPLR-------------------------QYHQTAE-EFGVTGVDR 49
            |.|.|.|.||:.:||:......|                         :||...| |.....|..
  Rat     3 LSRVRAVFFDLDNTLIDTAGASRRGMLEADHIQFILHIPATVIKLLQSKYHYKEEAEVICDKVQV 67

  Fly    50 RRLEQCFRQQFKAMSSEHPNFGRYSPGLDWQR--WWLQLVARTFSCVDHGLAPEKLEKIGQRLIS 112
            :..::||          ||    ||..:...|  .|.:.:..|....|:       .|:.:....
  Rat    68 KLSKECF----------HP----YSTCITDVRTSHWEEAIQETKGGADN-------RKLAEECYF 111

  Fly   113 VFRTSACWSHVNGAQ-------ELVQNVRNAGKCVGIISNFD-SSLPQVLDAMGFAGKFDFILTS 169
            :::::.. .|:...:       ||.:.||     :.:::|.| .:..:.::|......||.|:..
  Rat   112 LWKSTRL-QHMTLEEDVKAMLTELRKEVR-----LLLLTNGDRQTQREKIEACACQSYFDAIVVG 170

  Fly   170 YEAGVMKPERGIFEIPLQRLQIPAEQALHIGNKLDMDYEGARNCG-----W----SGLLVSNADN 225
            .|....||...||......|.:.....:.:|:.|:.|.:|..|.|     |    .|:.::::..
  Rat   171 GEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKSGGVPLTSSPM 235

  Fly   226 PH----SFASLSSLLEAL 239
            ||    |...|.:||:::
  Rat   236 PHYMVSSVLELPALLQSI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 48/248 (19%)
HAD-SF-IA-v1 16..214 CDD:273686 44/233 (19%)
NanpXP_038960978.1 CTE7 6..247 CDD:274057 51/267 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.