DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and C04E6.7

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001370372.1 Gene:C04E6.7 / 178976 WormBaseID:WBGene00015423 Length:241 Species:Caenorhabditis elegans


Alignment Length:77 Identity:21/77 - (27%)
Similarity:36/77 - (46%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 FDFILTSYEAGVMKPERGIFEIPLQRLQIPAEQALHIGNKLDMDYEGARNCGWSGLLVSNADNPH 227
            ||.::.|.:.||.||:...::|.|..:.:..|:.::|.:. .::.|.|...|...:.|.|     
 Worm   166 FDHVIESCKEGVKKPDPRFYQIALDCVDVQPEEVIYIDDS-KINCESAAVLGIRYIQVFN----- 224

  Fly   228 SFASLSSLLEAL 239
            |...|..|.|.|
 Worm   225 SMDMLEDLQEIL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 14/55 (25%)
HAD-SF-IA-v1 16..214 CDD:273686 13/50 (26%)
C04E6.7NP_001370372.1 HAD_sEH-N_like 24..233 CDD:319790 18/72 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157551
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.