DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15912 and acds-10

DIOPT Version :9

Sequence 1:	NP_572168.1	Gene:	CG15912 / 31385	FlyBaseID:	FBgn0029712	Length:	246	Species:	Drosophila melanogaster
Sequence 2:	NP_504508.1	Gene:	acds-10 / 178962	WormBaseID:	WBGene00019599	Length:	985	Species:	Caenorhabditis elegans

Alignment Length:	124	Identity:	33/124 - (26%)
Similarity:	56/124 - (45%)	Gaps:	40/124 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   128 ELVQNVRNAG-KCVGIISNFDSS----LPQVLDAMGFAGKFDFILTSYEAGVMKPERGIFEIPLQ 187
            ||::::|.|| :.:.|.:||.:.    ||.|...:|..  ||.:|.|...|:.||:..|:|:.|:
Worm   102 ELIKSLRLAGYRTILITNNFYTDRARLLPTVPSQVGLL--FDDVLESCRLGLRKPDTKIYELALE 164

  Fly   188 RLQ-----------------------------IPAEQALH-IGN--KLDMDY-EGARNC 213
            |.:                             :.::||:| :||  ||:..| ...|:|
Worm   165 RSKLHPSDCVFLDDLGSNLKSAKEMGITTIKVVSSQQAIHDLGNILKLNFSYPPETRDC 223

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15912	NP_572168.1	DREG-2	15..219	CDD:274056	33/124 (27%)
CG15912	NP_572168.1	HAD-SF-IA-v1	16..214	CDD:273686	33/124 (27%)
acds-10	NP_504508.1	HAD-1A3-hyp	2..212	CDD:274054	28/111 (25%)
		HAD_like	<96..200	CDD:304363	23/99 (23%)
		PLN02876	250..982	CDD:215473
		ACAD10_11_N-like	250..503	CDD:270703
		ACAD_FadE2	585..982	CDD:173844
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1011
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810