DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and bigr-1

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001254294.1 Gene:bigr-1 / 174706 WormBaseID:WBGene00009512 Length:226 Species:Caenorhabditis elegans


Alignment Length:246 Identity:50/246 - (20%)
Similarity:96/246 - (39%) Gaps:57/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLTSQFVANLKRFRLVTFDVTDTLLRLEDPLRQYHQTAEEFGVTGVDRRRLEQCFRQQFKAMSS 65
            |::|.|..|       |.:|....||..|..:.::...:...|:..              .|:.|
 Worm     1 MTMTQQIKA-------VVYDFGGVLLSYEGVMEKWVAMSRSLGLPD--------------DAVHS 44

  Fly    66 EHPNFGRYSPGLDWQRWW-----LQLVARTFSCVDHGLAPEKLE-KIGQRL---ISVFRTSACWS 121
            |       |.|:::.:|.     |.|...|...::.||..:.|: |.|.:|   :.:...:.|..
 Worm    45 E-------SVGIEFSQWLGPDRSLFLGTLTVDDLEGGLFLQYLKHKYGNKLTDNVVIKPFTECLR 102

  Fly   122 HVN-----GAQELVQNVRNAGKCVGIISN--------FDSSLPQVLDAMGFAGKFDFILTSYEAG 173
            ..|     ..|:.|:.:...|....:::|        .::.||..|.      .||.::.|....
 Worm   103 GENVKIHKNMQKTVEILHKKGFKTAMLTNNMFLDKEHKETRLPCDLT------HFDEVVESCLEH 161

  Fly   174 VMKPERGIFEIPLQRLQIPAEQALHIGNKLDMDYEGARNCGWSGLLVSNAD 224
            :|||:...:.:..:||.:..|:.:.: :.|..:.|.|...||:.:||.:.:
 Worm   162 LMKPDARFYHLVEKRLGVKPEEIVFL-DDLHENIEAAEKLGWNTILVEDIE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 44/225 (20%)
HAD-SF-IA-v1 16..214 CDD:273686 42/219 (19%)
bigr-1NP_001254294.1 HAD-1A3-hyp 6..223 CDD:274054 48/241 (20%)
HAD_like <101..209 CDD:304363 24/114 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.