DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15912 and acad10

DIOPT Version :9

Sequence 1:NP_572168.1 Gene:CG15912 / 31385 FlyBaseID:FBgn0029712 Length:246 Species:Drosophila melanogaster
Sequence 2:XP_004910566.1 Gene:acad10 / 100036613 XenbaseID:XB-GENE-967980 Length:1059 Species:Xenopus tropicalis


Alignment Length:250 Identity:59/250 - (23%)
Similarity:102/250 - (40%) Gaps:64/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KRFRLVTFDVTDTLLRLEDPLRQYHQTAEEFGVTG-VDRRRLEQCFRQQFKAMSSEHPNFGRYSP 75
            |.::.|.||:...|  |..|.|.    .:|:.:.. |....|:|..|           ..|...|
 Frog    40 KGYKAVIFDMGGVL--LPSPYRM----IKEWEICNKVPSGTLKQAIR-----------TGGHSGP 87

  Fly    76 GLDWQRWWLQLVARTFSCVDHGLAPEKLEKIGQRLISVFR-----TS-------ACWSHVNGAQE 128
            .:.:.|.  :|.|..|  |:|  ..|:...|....:.:||     ||       :|.:      :
 Frog    88 WMKFMRG--ELTAELF--VEH--FGEQCSNIAGSPVPIFRFLTDFTSGPMIEQHSCMT------Q 140

  Fly   129 LVQNVRNAGKCVGIISN------FDSSLPQVLDAMGFAGKFDFILTSYEAGVMKPERGIFEIPLQ 187
            .:|.:|:.|..:.::||      .:|.||  |:    ..:||.|:.|...||.||...|:::.::
 Frog   141 AIQCIRSEGLKIAVLSNNFFLHSGESFLP--LN----RSQFDVIVESCIEGVCKPSPQIYQLCVE 199

  Fly   188 RLQIPAEQALHIGNKLDMDYEGARNCGWSGLLVSNADNPHSFASLSSLLEALKTQ 242
            ||.:....::.: :.|:.:...|...|:|.:.|   |:|.      ..||.|:.|
 Frog   200 RLGVQPRDSIFL-DDLEQNVRAAAQLGFSTIKV---DDPR------ESLEQLEKQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15912NP_572168.1 DREG-2 15..219 CDD:274056 51/222 (23%)
HAD-SF-IA-v1 16..214 CDD:273686 49/216 (23%)
acad10XP_004910566.1 HAD-1A3-hyp 42..247 CDD:274054 57/247 (23%)
PLN02876 257..1058 CDD:215473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.