DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and Usf1

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_113965.1 Gene:Usf1 / 83586 RGDID:620974 Length:310 Species:Rattus norvegicus


Alignment Length:371 Identity:90/371 - (24%)
Similarity:142/371 - (38%) Gaps:114/371 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 TADLSEALVHSSFANGQQSLILTSD--TGNPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGC 112
            ||:..|..|..     |:..:.|.:  |...:.:.|.|..|         .|....|..:.|.|.
  Rat     7 TAETEEGTVQI-----QEGAVATGEDPTSVAIASIQSAATF---------PDPNVKYVFRTENGG 57

  Fly   113 DLDIHSLLPSNLQLPNNLQLPTGCEIYLVKETGSLMGEPPTKAAIKLELDTLSEKPLLPSVTTSS 177
            .:....:..|..||...           .:.:|::.|.|.|:        ::::..:..:.|:..
  Rat    58 QVMYRVIQVSEGQLDGQ-----------TEGSGAISGYPATQ--------SMTQAVIQGAFTSDD 103

  Fly   178 STQSAVITAQTVNPPIP------GNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHAQARSQPES 236
            :..:....|:|.....|      |:..||:.:|:...||            .|......::.|.|
  Rat   104 AVDAEGTAAETHYTYFPSTAVGDGSGGTTSGSTTAVVTT------------QGSEALLGQATPPS 156

  Fly   237 AGQ-----TP-------------------SSKLEAYK-KRDDKRRATHNEVERRRRDKINSWIFK 276
            .||     :|                   |.|.||.: .||:||||.|||||||||||||:||.:
  Rat   157 TGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQ 221

  Fly   277 LKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGNASSSSGRAPPNDSKSQILIKACEYIKS 341
            |.:::|..|..                            |:.||:     ||..||.|||:||:.
  Rat   222 LSKIIPDCSME----------------------------STKSGQ-----SKGGILSKACDYIQE 253

  Fly   342 MQGEIDTLRDCLRETDSLRASNQALREELDRLKRQQQL---QERFH 384
            ::.....|.:.|:..|.|:..|..||::::.||.:..|   |.|.|
  Rat   254 LRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHH 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 33/87 (38%)
Usf1NP_113965.1 HLH 200..255 CDD:278439 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11188
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5152
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002665
OrthoInspector 1 1.000 - - otm45046
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46117
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2414
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
99.010

Return to query results.
Submit another query.