DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and TFE3

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_006512.2 Gene:TFE3 / 7030 HGNCID:11752 Length:575 Species:Homo sapiens


Alignment Length:419 Identity:83/419 - (19%)
Similarity:135/419 - (32%) Gaps:140/419 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 STSPSSVNISNANPTAGPGLMTITNHHTADLSEALV------------HSSFANGQQSLILTSDT 75
            |.:|:|..||....:||.  .|::....|.:...::            |...|..||.....|.|
Human   144 SPAPASPAISVVGVSAGG--HTLSRPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTT 206

  Fly    76 GNPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGCDLDIHSLLPSNLQLPNNLQLPTGCEIYL 140
            ..|.:.||                     .:...||         |::.|     .||.....:.
Human   207 LGPKLASQ---------------------ALTPPPG---------PASAQ-----PLPAPEAAHT 236

  Fly   141 VKETGSLMGEPPTKAAI----KLELDTLSEKPL-------------LPSVTTSSSTQSAVITAQT 188
            ...|||....|.....|    :.|:|.:.::.:             ||..||.....|.:     
Human   237 TGPTGSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTTGLQLPSTL----- 296

  Fly   189 VNPPIPGNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAYKKRDD 253
               |:.||:....|:....|....:..|         ..|:..:......:|.:..|...:::.|
Human   297 ---PVSGNLLDVYSSQGVATPAITVSNS---------CPAELPNIKREISETEAKALLKERQKKD 349

  Fly   254 KRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGNASSS 318
                .||.:|||||..||..|.:|..::|.          |:.|....                 
Human   350 ----NHNLIERRRRFNINDRIKELGTLIPK----------SSDPEMRW----------------- 383

  Fly   319 SGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREELDRLKRQQQLQERF 383
                    :|..||..:.:||:.:|.|....:|......||..:|::|:..:..|    :||.:.
Human   384 --------NKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQANRSLQLRIQEL----ELQAQI 436

  Fly   384 H------TAGGRSTFNVTLNSLNSSATSD 406
            |      |.|        |.||.:::.||
Human   437 HGLPVPPTPG--------LLSLATTSASD 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 19/87 (22%)
TFE3NP_006512.2 MITF_TFEB_C_3_N 113..266 CDD:374248 31/158 (20%)
bHLHzip_TFE3 337..427 CDD:381498 28/128 (22%)
DUF3371 432..573 CDD:371761 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.