DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and SREBF2

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_004590.2 Gene:SREBF2 / 6721 HGNCID:11290 Length:1141 Species:Homo sapiens


Alignment Length:454 Identity:92/454 - (20%)
Similarity:151/454 - (33%) Gaps:160/454 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PRLNMEFGSSTSNTNTSTSPSSVNISNANPTAGPGLMTITNHHTADLSEALVHSSFANGQQSLIL 71
            |.|.::    .|.|:..|:|.:..|....|...|...|.....|     .::..:|:...|:.|:
Human   110 PTLQVK----VSPTSVPTTPRATPILQPRPQPQPQPQTQLQQQT-----VMITPTFSTTPQTRII 165

  Fly    72 TSDTGNPLMNSQGAQIFLTICGDENS--DDSQ-EYYTIKQE-----------PGCDLDIHSLLPS 122
            .    .||:....|..|..:.....|  ..|| :..||:|:           ...:..:.:|.|:
Human   166 Q----QPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPA 226

  Fly   123 NLQ---LPNNLQLPTGCEIYLVKETGSLM------GEPPTKAAIKLELDTLSEKPLLPSVTTSSS 178
            .:|   .|...|:|...:..::| |.||:      ...|..||:        :.|.|.::||...
Human   227 TVQTVAAPQVQQVPVLVQPQIIK-TDSLVLTTLKTDGSPVMAAV--------QNPALTALTTPIQ 282

  Fly   179 TQSAVITAQTVNPPIPGNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHAQARSQPESAGQTPSS 243
            |.:..:      |.:.|      |:.:..||..|:.|                .:.....|.|..
Human   283 TAALQV------PTLVG------SSGTILTTMPVMMG----------------QEKVPIKQVPGG 319

  Fly   244 KLEAYKKRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGS 308
            ..:....::.:||.|||.:|:|.|..||..|.:||:::                     ..|:..
Human   320 VKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLV---------------------MGTDAK 363

  Fly   309 SHSKGNASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREELDRL 373
            .|                 ||.:|.||.:|||.:|                 ..|..||:|    
Human   364 MH-----------------KSGVLRKAIDYIKYLQ-----------------QVNHKLRQE---- 390

  Fly   374 KRQQQLQERFHTAGGRSTFNVTLNSLNSSATSDLFEGIDTTPNLAAVSSLGFGKRGLLISDFDE 437
                               |:.|...|..  :.|.:|||       :.||...:..|.|.||::
Human   391 -------------------NMVLKLANQK--NKLLKGID-------LGSLVDNEVDLKIEDFNQ 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 23/87 (26%)
SREBF2NP_004590.2 Transcriptional activation (acidic). /evidence=ECO:0000250|UniProtKB:P36956 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..144 9/37 (24%)
Interaction with LMNA. /evidence=ECO:0000250|UniProtKB:Q3U1N2 237..491 64/314 (20%)
HLH 331..381 CDD:278439 23/87 (26%)
Leucine-zipper 380..401 8/62 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.