DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and Max

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_071546.1 Gene:Max / 60661 RGDID:621101 Length:160 Species:Rattus norvegicus


Alignment Length:162 Identity:40/162 - (24%)
Similarity:67/162 - (41%) Gaps:55/162 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 RRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGNASSSS 319
            :||.||.:||:|||.|......|::.:|||....:                              
  Rat    24 KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKA------------------------------ 58

  Fly   320 GRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREE---LDRLKRQQQLQE 381
                   |::|||.||.|||:.|:.:..|.:   ::.|.|:..|..|.::   |::.:...|||.
  Rat    59 -------SRAQILDKATEYIQYMRRKNHTHQ---QDIDDLKRQNALLEQQVRALEKARSSAQLQT 113

  Fly   382 RFHTAGGRSTFNVTLNSLNSSA---TSDLFEG 410
            .:.::.         |||.::|   |...|:|
  Rat   114 NYPSSD---------NSLYTNAKGGTISAFDG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 23/87 (26%)
MaxNP_071546.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 9/15 (60%)
bHLHzip_Max 24..92 CDD:381412 27/107 (25%)
Leucine-zipper 81..102 4/23 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 105..160 10/41 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.