DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and SREBP

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster


Alignment Length:248 Identity:54/248 - (21%)
Similarity:90/248 - (36%) Gaps:80/248 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 ITAQTVNPPIPGNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAY 248
            :.:.|.:||:.....:|.|..|......:               |.:.:..|..|:.|.::::  
  Fly   230 VASPTPSPPVAPPPTSTGSRASKVRVAPL---------------APSPAAMEVQGKVPINRVQ-- 277

  Fly   249 KKRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKG 313
            .|..:.:|:.||.:|||.|..||..|.:||.::.                         ...:|.
  Fly   278 PKVKEVKRSAHNAIERRYRTSINDKINELKNLVV-------------------------GEQAKL 317

  Fly   314 NASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREEL---DRLKR 375
            |             ||.:|.|:          ||.:||..|:...|:|..|.|:.||   |..|.
  Fly   318 N-------------KSAVLRKS----------IDKIRDLQRQNHDLKAELQRLQRELMARDGSKV 359

  Fly   376 QQQLQERFHTAGGRSTFNVTLNSLNSSATSDLFEGI------DTTPNLAAVSS 422
            :..||  ..|..||:    :.....||.|.....|:      ::.|:|:.:.|
  Fly   360 KDLLQ--LGTRPGRA----SKKRRESSQTFTTDAGLTPPRSDESDPSLSPMHS 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 18/87 (21%)
SREBPNP_001262064.1 HLH 281..338 CDD:238036 23/104 (22%)
OmpH <289..>364 CDD:281871 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.