DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and Mitf

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001245436.1 Gene:Mitf / 3885647 FlyBaseID:FBgn0263112 Length:837 Species:Drosophila melanogaster


Alignment Length:397 Identity:87/397 - (21%)
Similarity:152/397 - (38%) Gaps:104/397 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PSSVNISNA--NPTAGPGLMTITNHHTADLSEALVHSSFANGQQSLIL---TSDTGNPLMNSQGA 85
            |..:.:|..  |||....:....|.....|||:...|.:.:....:.|   ::.||| |.||   
  Fly   274 PQVLQVSTVLENPTRYHVIQKQKNQVRQYLSESFKPSMWGSHTSEIKLANNSASTGN-LQNS--- 334

  Fly    86 QIFLTICGDENSDDSQEYYTIKQEPGCDLDIHS--LLPSNLQLPNNLQLPTG-----C------E 137
            .:...||  :..:.:..:       |||..:.:  ::||:..:|.:   |.|     |      |
  Fly   335 SLQKGIC--DPLERTNRF-------GCDSAVSAKRIMPSDDAMPIS---PFGGSFVRCDDINPIE 387

  Fly   138 IYLVKETGSLMGEPP----------TKAAIKLELDTLSEKPLLPSVTTSSSTQSAVITAQTVNPP 192
            ..:::......|||.          :||...|. .|.|...::.|:..||::.|...|:..::| 
  Fly   388 PTVLRPNSHGAGEPENAHRTAQLGLSKANSSLS-STRSSSGIVNSIRISSTSSSLQSTSAPISP- 450

  Fly   193 IPGNINTTTSTTSTTTTTS--------VLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAYK 249
                     |.:|..|:.|        :|.....|...:.::....:.:|::......:.|    
  Fly   451 ---------SVSSVATSVSEPDDIFDDILQNDSFNFDKNFNSELSIKQEPQNLTDAEMNAL---- 502

  Fly   250 KRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGN 314
            .:|.:::..||.:|||||..||..|.:|..:||  ..|.:|.|....                  
  Fly   503 AKDRQKKDNHNMIERRRRFNINDRIKELGTLLP--KGSDAFYEVVRD------------------ 547

  Fly   315 ASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQAL--REELDRLKRQQ 377
                   ..||  |..||..:.:|||.::.|:..||.     :.||.....|  |:.:.|:| :.
  Fly   548 -------IRPN--KGTILKSSVDYIKCLKHEVTRLRQ-----NELRQRQVELQNRKLMSRIK-EL 597

  Fly   378 QLQERFH 384
            ::|.:.|
  Fly   598 EMQAKSH 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 24/87 (28%)
MitfNP_001245436.1 MITF_TFEB_C_3_N <272..>311 CDD:292573 9/36 (25%)
HLH 505..570 CDD:238036 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.