DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and Tfe3

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001258156.1 Gene:Tfe3 / 317376 RGDID:1559642 Length:573 Species:Rattus norvegicus


Alignment Length:413 Identity:83/413 - (20%)
Similarity:132/413 - (31%) Gaps:128/413 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 STSPSSVNISNANPTAGPGLMTITNHHTADLSEALV------------HSSFANGQQSLILTSDT 75
            |.:|:|..||....:||.  .|::....|.:...::            |...|..||.....|.|
  Rat   143 SPAPASPAISVIGVSAGG--HTLSRPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTT 205

  Fly    76 GNPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGCDLDIHSLLPSNLQLPNNLQLPTGCEIYL 140
            ..|.:.||                     .:...||         ||:.|     .||.....:.
  Rat   206 LGPKLASQ---------------------ALTPPPG---------PSSAQ-----PLPAPETAHA 235

  Fly   141 VKETGSLMGEPPTKAAI----KLELDTLSEKPL-------------LPSVTTSSSTQSAVITAQT 188
            ...|||....|.....|    :.|:|.:.::.:             ||..|......|.:     
  Rat   236 TGPTGSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTAGLQLPSTL----- 295

  Fly   189 VNPPIPGNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAYKKRDD 253
               |:.||:....|:....|....:..|         ..|:..:......:|.:..|...:::.|
  Rat   296 ---PVSGNLLDVYSSQGVATPAITVSNS---------CPAELPNIKREISETEAKALLKERQKKD 348

  Fly   254 KRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGNASSS 318
                .||.:|||||..||..|.:|..::|.          |..|....                 
  Rat   349 ----NHNLIERRRRFNINDRIKELGTLIPK----------SNDPEMRW----------------- 382

  Fly   319 SGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREELDRLKRQQQLQERF 383
                    :|..||..:.:||:.:|.|....:|......||..:|::|:..:..|:.|.|:.   
  Rat   383 --------NKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQANRSLQLRIQELELQAQIH--- 436

  Fly   384 HTAGGRSTFNVTLNSLNSSATSD 406
               |.....|..|.||.:|:.||
  Rat   437 ---GLPVPPNPGLLSLATSSVSD 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 19/87 (22%)
Tfe3NP_001258156.1 MITF_TFEB_C_3_N 112..264 CDD:292573 32/157 (20%)
HLH 343..403 CDD:238036 22/98 (22%)
DUF3371 431..571 CDD:288684 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.