DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and Tfeb

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001020878.1 Gene:Tfeb / 316214 RGDID:1309583 Length:535 Species:Rattus norvegicus


Alignment Length:394 Identity:72/394 - (18%)
Similarity:119/394 - (30%) Gaps:161/394 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFGSSTSNTNTSTSPSSVNISNANPTAGPGLMTITNHHTADLSEALVHSSFANGQQSLILTSDTG 76
            :|.:..|....|..|.        |.|.||:.  ..|                     :|::..|
  Rat   162 KFAAHVSPAQGSPKPP--------PAASPGVR--AGH---------------------VLSTSAG 195

  Fly    77 NPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGCDLDIHSLLPSNLQLPNNLQLPTG-CEIYL 140
            |...||..|.:.::...::..||     .|......|..:..:.| .:|:||.|.|.:. ..:| 
  Rat   196 NSAPNSPMAMLHISSNPEKEFDD-----VIDNIMRLDSVLGYINP-EMQMPNTLPLSSSHLNVY- 253

  Fly   141 VKETGSLMGEPPTKAAIKLELDTLSEKPLLPSVTTSSSTQSAVITAQTVNPPIPGNINTTTSTTS 205
                   .|:|...|:             |..||:||               .|.::......|.
  Rat   254 -------SGDPQVTAS-------------LVGVTSSS---------------CPADLTQKRELTD 283

  Fly   206 TTTTTSVLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAYKKRDDKRRATHNEVERRRRDKI 270
                                  |::|:..:..           :|:|:     ||.:|||||..|
  Rat   284 ----------------------AESRALAKER-----------QKKDN-----HNLIERRRRFNI 310

  Fly   271 NSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGNASSSSGRAPPND-----SKSQ 330
            |..|.:|..::|.                                        .||     :|..
  Rat   311 NDRIKELGMLIPK----------------------------------------ANDLDVRWNKGT 335

  Fly   331 ILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREELDRLKRQQQLQERFHTAGGRSTFNVT 395
            ||..:.:||:.||.::...|:....:..|..:|:.|...:..|    ::|.|.|.....|...|.
  Rat   336 ILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQEL----EMQARVHGLPTTSPSGVN 396

  Fly   396 LNSL 399
            :..|
  Rat   397 MAEL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 19/92 (21%)
TfebNP_001020878.1 MITF_TFEB_C_3_N 63..220 CDD:292573 17/93 (18%)
HLH 292..352 CDD:238036 23/115 (20%)
DUF3371 380..516 CDD:288684 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.