DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and TFEC

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:XP_011514265.1 Gene:TFEC / 22797 HGNCID:11754 Length:437 Species:Homo sapiens


Alignment Length:377 Identity:76/377 - (20%)
Similarity:116/377 - (30%) Gaps:154/377 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ANPTAGPGLMTITNHHTADLSEALVHSSFANGQQSLILTSDTG---NPLMNSQGAQIFLTICGDE 95
            |.|:.||   .:.:.||.                   |.||.|   |||..       |...|.|
Human   108 AVPSGGP---LVQHAHTT-------------------LDSDAGLTENPLTK-------LLAIGKE 143

  Fly    96 NSDDSQEYYTIKQEPGCDLDIHSLLPSNLQLPNNLQLPTGCEIYLVKETGSLMGEPPTKAAIKLE 160
              ||:.:::           :..::...:.:.::.           ||.|               
Human   144 --DDNAQWH-----------MEDVIEDIIGMESSF-----------KEEG--------------- 169

  Fly   161 LDTLSEKPLLPSVTTSSSTQSAVITAQTVNPPIPGNINTTTSTTSTTTTTSVLYGSHGNGHGHGH 225
                ::.|||...|.|.|........|.::|     ||...::.|..:                 
Human   170 ----ADSPLLMQRTLSGSILDVYSGEQGISP-----INMGLTSASCPS----------------- 208

  Fly   226 AHAQARSQPESAGQTPSSKLEAYKKRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSF 290
                  |.|.....|.:......|:|  :::..||.:|||||..||..|.:|..::|.       
Human   209 ------SLPMKREITETDTRALAKER--QKKDNHNLIERRRRYNINYRIKELGTLIPK------- 258

  Fly   291 SEASTSPSTSGSTSTNGSSHSKGNASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRE 355
               |..|....                         :|..||..:.||||.:|.|....|:....
Human   259 ---SNDPDMRW-------------------------NKGTILKASVEYIKWLQKEQQRARELEHR 295

  Fly   356 TDSLRASNQALREELDRLKRQQQLQERFHTAGGRSTFNVTLNSLNSSATSDL 407
            ...|..:|:.|      |.|.|:|:.:..|.|        |.:|.|..|.||
Human   296 QKKLEQANRRL------LLRIQELEIQARTHG--------LPTLASLGTVDL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 21/87 (24%)
TFECXP_011514265.1 MITF_TFEB_C_3_N 6..155 CDD:292573 18/88 (20%)
HLH 227..287 CDD:238036 24/96 (25%)
DUF3371 315..434 CDD:288684 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.