DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and Srebf1

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_035610.1 Gene:Srebf1 / 20787 MGIID:107606 Length:1134 Species:Mus musculus


Alignment Length:351 Identity:75/351 - (21%)
Similarity:119/351 - (33%) Gaps:112/351 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 HSLLPSNLQ--LPNNLQLPTGCEIYLVKETGSLMGEPPTKAAIKLELDTLSEKPLLPSVTTSSST 179
            :|.|||...  ||.|.|.|.. .:.|....|.|    || .|:..::.:|:.:..||:   |::.
Mouse   162 YSSLPSGFSGTLPGNTQQPPS-SLPLAPAPGVL----PT-PALHTQVQSLASQQPLPA---SAAP 217

  Fly   180 QSAVITAQTVNPPIP-------------GNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHAQAR 231
            ::..:|:|....|:.             ..:.|....|..|...|.|        ..|.|.....
Mouse   218 RTNTVTSQVQQVPVVLQPHFIKADSLLLTAVKTDAGATVKTAGISTL--------APGTAVQAGP 274

  Fly   232 SQPESAGQT--------------PSSKLEAYKK-------RDDKRRATHNEVERRRRDKINSWIF 275
            .|...:|.|              |..:|.|..|       |.:||.| ||.:|:|.|..||..|.
Mouse   275 LQTLVSGGTILATVPLVVDTDKLPIHRLAAGSKALGSAQSRGEKRTA-HNAIEKRYRSSINDKIV 338

  Fly   276 KLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGNASSSSGRAPPNDSKSQILIKACEYIK 340
            :||:::..       :||..                               :||.:|.||.:||:
Mouse   339 ELKDLVVG-------TEAKL-------------------------------NKSAVLRKAIDYIR 365

  Fly   341 SMQGEIDTLRDCLRETDSLRASNQALREE---LDRLKRQQQLQERFHTAGGRSTFNVTLNSLNSS 402
            .:|                 .|||.|::|   |....:.:.|::.....|.....:|::..:...
Mouse   366 FLQ-----------------HSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPE 413

  Fly   403 ATSDLFEGIDTTPNLAAVSSLGFGKR 428
            ....|........:.:..|.|.||.|
Mouse   414 VVETLTPPPSDAGSPSQSSPLSFGSR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 21/87 (24%)
Srebf1NP_035610.1 Transcriptional activation (acidic). /evidence=ECO:0000250|UniProtKB:P36956 1..60
9aaTAD. /evidence=ECO:0000250|UniProtKB:P36956 27..35
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..73
ERbeta_N 114..210 CDD:289279 16/53 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..195 8/29 (28%)
Interaction with LMNA. /evidence=ECO:0000269|PubMed:11929849 227..487 54/277 (19%)
HLH 315..372 CDD:238036 25/112 (22%)
Leucine-zipper 367..388 7/37 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..468 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.