DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usf and mxl-1

DIOPT Version :9

Sequence 1:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_505856.1 Gene:mxl-1 / 179557 WormBaseID:WBGene00003509 Length:124 Species:Caenorhabditis elegans


Alignment Length:128 Identity:38/128 - (29%)
Similarity:51/128 - (39%) Gaps:40/128 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 DDKR--RATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGN 314
            |.||  |..||.:||||||.|......|:|::|                     ..||..     
 Worm    25 DPKRHAREQHNALERRRRDNIKDMYTSLREVVP---------------------DANGER----- 63

  Fly   315 ASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREELDRLKRQQ 377
                     ...|::.||.||.|.|:..|.:..||...:.|.:|   .|..||||:.|||.::
 Worm    64 ---------VQASRAVILKKAIESIEKGQSDSATLSVDVAEQES---KNAKLREEIARLKAKK 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UsfNP_572167.3 HLH 255..343 CDD:278439 23/89 (26%)
mxl-1NP_505856.1 bHLH_SF 31..100 CDD:412148 27/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.878984 Normalized mean entropy S4388
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.