DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and ERP4

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_014659.1 Gene:ERP4 / 854181 SGDID:S000005542 Length:207 Species:Saccharomyces cerevisiae


Alignment Length:211 Identity:46/211 - (21%)
Similarity:90/211 - (42%) Gaps:28/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLLLVGSLLILCRTSHAFI-------VSVDAHNEECFFENVEGGTK-FGVTFEVIDGGFLDVDI 63
            :|..|:..|......:|||.       :|:.|..:||.:.::..... ..|:::|:.||..::|.
Yeast     2 RVFTLIAILFSSSLLTHAFSSNYAPVGISLPAFTKECLYYDLSSDKDVLVVSYQVLTGGNFEIDF 66

  Fly    64 KISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPG 128
            .|:.||..|:....::....:...:...|.||.|.:|...: :||.|..:::            .
Yeast    67 DITAPDGSVIVTERQKKHSDFLLKSFGIGKYTFCLSNNYGT-SPKKVEITLE------------K 118

  Fly   129 EEEV--GHTKLEDM-----IRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALV 186
            |:|:  .|...||:     |.|:...|..:....:|:..|:..:.....:|.||:...|.....|
Yeast   119 EKEIVSSHESKEDIIANNAIEEIDRNLNKITKTMDYLRAREWRNMYTVSSTESRLTWLSLLIMGV 183

  Fly   187 LVLMTVGQVYYLKRFF 202
            :|.:::.|...::.||
Yeast   184 MVGISIVQALIIQFFF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 42/194 (22%)
ERP4NP_014659.1 EMP24_GP25L 29..199 CDD:395878 38/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53803
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.