DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and ERP1

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_009402.1 Gene:ERP1 / 851264 SGDID:S000002129 Length:219 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:50/221 - (22%)
Similarity:91/221 - (41%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAKVLLLVGSLLILCRTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEV----------IDGGFL 59
            |..:|.:....|:|.....||.........:||.:.:..||.|..|::.          .|.|..
Yeast     3 LTSLLQVFACCLVLPAQVTAFYYYTSGAERKCFHKELSKGTLFQATYKAQIYDDQLQNYRDAGAQ 67

  Fly    60 D----VDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKL---VMFSIDVG 117
            |    :||:.:..|||::...:..:||..||:|...|.:.:|...|......|.   :.....||
Yeast    68 DFGVLIDIEETFDDNHLVVHQKGSASGDLTFLASDSGEHKICIQPEAGGWLIKAKTKIDVEFQVG 132

  Fly   118 DAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTF 182
            ...:.........::.|.|    :..|:..:..::.||:.|..|:...|..:|..|||.:.|...
Yeast   133 SDEKLDSKGKATIDILHAK----VNVLNSKIGEIRREQKLMRDREATFRDASEAVNSRAMWWIVI 193

  Fly   183 EALVLVLMTVGQVYYLKRFFEVKRVV 208
            :.:||.:....|:.:|.:||..::::
Yeast   194 QLIVLAVTCGWQMKHLGKFFVKQKIL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 45/195 (23%)
ERP1NP_009402.1 EMP24_GP25L 22..213 CDD:395878 44/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.