DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and ERP2

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_009395.1 Gene:ERP2 / 851226 SGDID:S000000005 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:44/213 - (20%)
Similarity:99/213 - (46%) Gaps:18/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESTLA-------KVLLLVGSLLILCRTSHAFI-VSVDAHNEEC-FFENVEGGTKFGVTFEVIDG 56
            ::||:|       .:|.||.|  :...:|:|.: :|:.|.::|| :::.|.......|.::|:.|
Yeast     2 IKSTIALPSFFIVLILALVNS--VAASSSYAPVAISLPAFSKECLYYDMVTEDDSLAVGYQVLTG 64

  Fly    57 GFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQ 121
            |..::|..|:.||..|:...:::....:...:...|.||.||:|...:...|     :::....:
Yeast    65 GNFEIDFDITAPDGSVITSEKQKKYSDFLLKSFGVGKYTFCFSNNYGTALKK-----VEITLEKE 124

  Fly   122 RAPGAPGEEEVGHTKL--EDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEA 184
            :......|.:|.:..:  .:.:.|:...|..:.....|:..|:..:.|...:|.||:...|....
Yeast   125 KTLTDEHEADVNNDDIIANNAVEEIDRNLNKITKTLNYLRAREWRNMSTVNSTESRLTWLSILII 189

  Fly   185 LVLVLMTVGQVYYLKRFF 202
            :::.::::.||..::..|
Yeast   190 IIIAVISIAQVLLIQFLF 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 36/183 (20%)
ERP2NP_009395.1 EMP24_GP25L 34..183 CDD:395878 31/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53803
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.