DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and p24beta2

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_187425.1 Gene:p24beta2 / 819959 AraportID:AT3G07680 Length:208 Species:Arabidopsis thaliana


Alignment Length:214 Identity:63/214 - (29%)
Similarity:95/214 - (44%) Gaps:25/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLAKVLLLVGSLLILCRT-SHAFIVSVDAHNEECFFENVE-GGTKFGVTFEVI----------DG 56
            :|...::|:|.|.....| ...|::.    .||||....| .|....|:|.||          ||
plant     2 SLKGTIVLLGLLWSFQATLGIRFVID----REECFSHKAEYEGDTLHVSFVVIKSDSQWHFNEDG 62

  Fly    57 GFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQ 121
                ||:.|.||....:|:..::.|.|:.||...||.|..||.|:  |...:.:.|.:.:|....
plant    63 ----VDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNK--SPYHETIDFDVQLGHFAY 121

  Fly   122 RAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALV 186
            ....|..|.   .|.|.:.|.:|...|.:::.||.::..:......||||.:.|.|..:.||:..
plant   122 YDQHAKDEH---FTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFESFA 183

  Fly   187 LVLMTVGQVYYLKRFFEVK 205
            |:..:..|||.|:|.||.|
plant   184 LIGASFLQVYLLRRLFERK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 55/189 (29%)
p24beta2NP_187425.1 EMP24_GP25L 21..200 CDD:279450 55/191 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2948
eggNOG 1 0.900 - - E1_KOG1692
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2316
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1328081at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm1213
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.