DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and tmed1

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001039263.1 Gene:tmed1 / 734138 XenbaseID:XB-GENE-1017173 Length:220 Species:Xenopus tropicalis


Alignment Length:193 Identity:57/193 - (29%)
Similarity:87/193 - (45%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYT 95
            |..:|||::.........:.::||.|..||||..::.|...::....:.|.|.:|......|.|.
 Frog    33 AGRQECFYQTTLYNGSMEIEYQVIGGAGLDVDFSVTTPSGILLIMERRRSDGVHTVEPTEAGDYM 97

  Fly    96 VCFNNERSSMTPKLVMFSI----DVGD-APQRAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQ 155
            :||:|..|:::.|||.|.:    ..|| .|.........:|:...|||| |:|   ::.|||...
 Frog    98 ICFDNSFSTISEKLVFFELIFDNQQGDEEPDSWADVVEPDELLDIKLED-IKE---SIESVKSRL 158

  Fly   156 E----------YMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVKRVV 208
            |          ....||   |::.::...||..||.....|||.:...|||.||..|:.||.:
 Frog   159 ERSIQMQTVLRAFEARD---RNLQDSNLERVNFWSAINVGVLVTVAFLQVYMLKSLFDDKRKI 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 54/186 (29%)
tmed1NP_001039263.1 EMP24_GP25L 26..212 CDD:366467 54/185 (29%)
COPI vesicle coat-binding. /evidence=ECO:0000255 211..220 3/8 (38%)