DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and Tmed7

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_079974.1 Gene:Tmed7 / 66676 MGIID:1913926 Length:224 Species:Mus musculus


Alignment Length:199 Identity:74/199 - (37%)
Similarity:111/199 - (55%) Gaps:6/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVGSLLILCRTSHAFIVSVDA--HNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVM 73
            |:..||:|...|....::.:.  :.::||:|::..|||..:.|:||.||..|||.::..||..|:
Mouse    21 LLALLLLLPAPSGGSEITFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGKVL 85

  Fly    74 HESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVGH-TKL 137
            ::..|:....:||.|...|||..||:||.|:.|.|.|.|...||:.|   |..|.|..|.. |::
Mouse    86 YKEMKKQYDSFTFTASRNGTYKFCFSNEFSTFTHKTVYFDFQVGEDP---PLFPSENRVSALTQM 147

  Fly   138 EDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFF 202
            |.....:...|.||...|.:..:|:...||..|:.|:||..||..|||:|::::||||:.||.||
Mouse   148 ESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSVGQVFLLKSFF 212

  Fly   203 EVKR 206
            ..||
Mouse   213 SDKR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 66/181 (36%)
Tmed7NP_079974.1 EMP24_GP25L 36..213 CDD:307313 66/179 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.