DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and Tmed3

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_079636.2 Gene:Tmed3 / 66111 MGIID:1913361 Length:221 Species:Mus musculus


Alignment Length:204 Identity:69/204 - (33%)
Similarity:101/204 - (49%) Gaps:5/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLVGSLLILCRT----SHAFIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPD 69
            :||...||:|.|.    |......:..:.::||.|.||.|.||.:.::||.||..|||..:..|.
Mouse    13 MLLQLLLLLLLRAEPLRSAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPR 77

  Fly    70 NHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVGH 134
            .:|::...|:....:|:...|||.|..||:||.|:.:.|.|.|...|||.|...|.. |......
Mouse    78 GNVIYRETKKQYDSFTYKTEAKGVYRFCFSNEFSTFSHKTVYFDFQVGDEPPILPDM-GNRVTAL 141

  Fly   135 TKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLK 199
            |::|.....:...|.:|...|.:..:|:...|:..|:.||||..||..|.:.|.:::..||..||
Mouse   142 TQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLK 206

  Fly   200 RFFEVKRVV 208
            .||..||.|
Mouse   207 SFFTEKRPV 215

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 58/178 (33%)
Tmed3NP_079636.2 EMP24_GP25L 32..209 CDD:307313 57/177 (32%)
COPI vesicle coat-binding. /evidence=ECO:0000255 208..221 5/8 (63%)