DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and Tmed2

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_036021223.1 Gene:Tmed2 / 56334 MGIID:1929269 Length:208 Species:Mus musculus


Alignment Length:212 Identity:125/212 - (58%)
Similarity:162/212 - (76%) Gaps:13/212 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLAKVLLLVGSLLILCRTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGP 68
            |||::|.|:.:||   .|:..:.||:|||.||||||.|..|||.|:.|||.:|||||:|::|:||
Mouse     3 TLAELLALLAALL---ATASGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGP 64

  Fly    69 DNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVG 133
            ||..:::.::||||||||.|...|||..||:|..|:||||:|||:||:|:||:   |...|.|.|
Mouse    65 DNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPK---GQDMETEGG 126

  Fly   134 -------HTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMT 191
                   ..|||:||.||:..:|:||||||||.||::|||::|:||||||||||.|||||||.||
Mouse   127 GDSWDAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMT 191

  Fly   192 VGQVYYLKRFFEVKRVV 208
            :||:|||||||||:|||
Mouse   192 LGQIYYLKRFFEVRRVV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 111/185 (60%)
Tmed2XP_036021223.1 EMP24_GP25L 23..203 CDD:395878 111/182 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 238 1.000 Domainoid score I2305
eggNOG 1 0.900 - - E1_KOG1692
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55991
Inparanoid 1 1.050 255 1.000 Inparanoid score I3175
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53803
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - oto93612
orthoMCL 1 0.900 - - OOG6_101558
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R395
SonicParanoid 1 1.000 - - X4219
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.860

Return to query results.
Submit another query.