DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and tmed7

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001300637.1 Gene:tmed7 / 405848 ZFINID:ZDB-GENE-040426-2570 Length:216 Species:Danio rerio


Alignment Length:174 Identity:65/174 - (37%)
Similarity:98/174 - (56%) Gaps:4/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCF 98
            ::||:|::..|||..:.|:|:.||..|||.::..|:..|:::..|:....:||.|...|||..||
Zfish    38 KQCFYEDITIGTKCTLEFQVVTGGHYDVDCRLEDPEGTVLYKEMKKQYDSFTFSAARNGTYKFCF 102

  Fly    99 NNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEV-GHTKLEDMIRELSGTLTSVKHEQEYMHVRD 162
            :||.|:.|.|.|.|...|||.|   |..|.|..| ..|::|.....:...|.||...|.:..:|:
Zfish   103 SNEFSTFTHKTVYFDFQVGDDP---PLFPNENRVTALTQMESACVSIHEALKSVMDYQTHFRLRE 164

  Fly   163 KIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVKR 206
            ...||..|:.||||..||..|||:|::::|.||..|:.||..::
Zfish   165 AQGRSRAEDLNSRVAFWSVGEALILLVVSVSQVLLLRSFFSDRK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 64/169 (38%)
tmed7NP_001300637.1 EMP24_GP25L 28..205 CDD:279450 64/169 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.