DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and tmed5

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_956697.1 Gene:tmed5 / 393374 ZFINID:ZDB-GENE-040426-1302 Length:225 Species:Danio rerio


Alignment Length:218 Identity:60/218 - (27%)
Similarity:104/218 - (47%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGSLLILCRTSHAFIVSVD--------AHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGP 68
            |..|.:....:.||..|:|        |...||||:.::......:.::|:||..||||.:::.|
Zfish    12 VACLSVCVSLASAFSQSLDSDFTFTLAAGRRECFFQTMKKDASLEIEYQVLDGASLDVDFQLNSP 76

  Fly    69 DNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEE-- 131
            ..|::....::|.|.:| |...:|.|..||:|..|:::.|::.|.:.:.:.        ||:|  
Zfish    77 SGHIIASDYRKSDGVHT-VETEEGDYMFCFDNTFSAVSEKVIFFELILDNM--------GEDEES 132

  Fly   132 ------VGHTKLEDM-IRELSGTLTSVKHE-------QEYMHVRDKIHRSVNENTNSRVVLWSTF 182
                  |....|.|| :.::..|:.:||..       |..:...:...|::.|:...||.|||..
Zfish   133 EDWKAYVQGADLLDMKLEDIMDTINNVKSRLGKSLQIQTLLRAFEARDRNLQESNYERVNLWSCT 197

  Fly   183 EALVLVLMTVGQVYYLKRFFEVK 205
            ..||:|:::..|||.|:..||.|
Zfish   198 NVLVMVIVSGVQVYLLRSLFEDK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 55/202 (27%)
tmed5NP_956697.1 EMP24_GP25L 32..218 CDD:279450 51/194 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.