DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and loj

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster


Alignment Length:191 Identity:48/191 - (25%)
Similarity:89/191 - (46%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAK 91
            |.:||..|:|:.:.|:.|..|.|:|.|:.||.......:..|...|:...:.:::..||......
  Fly    50 VHIDAGKEDCYHQYVKAGATFYVSFSVVRGGDGMAGFAVRNPAGEVVKPYQWQATADYTDQVSPG 114

  Fly    92 GTYTVCFNNERSSMTPKLVMFSIDV--GDAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHE 154
            |.|:||.:|:.|....|||...|.|  .||..:.     .:|:...:|.  ::..:.|:.:|:..
  Fly   115 GYYSVCIDNQFSRFAGKLVNIYITVVKYDAWDKY-----AKEIEQLQLN--MQNFTATVGTVERN 172

  Fly   155 QEYM-----HVRDKIHRSVNE-----NTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVK 205
            ...|     |.|   ||...:     :.|:.:..:|..:.:|:::....||:::::.||||
  Fly   173 INDMMGYQAHSR---HRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 44/187 (24%)
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 44/187 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.