DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and Ticam2

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001102360.1 Gene:Ticam2 / 364867 RGDID:1308258 Length:232 Species:Rattus norvegicus


Alignment Length:134 Identity:29/134 - (21%)
Similarity:48/134 - (35%) Gaps:54/134 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAP---QRAPGAPGEEEVGHT 135
            |||:.:                   |:|.:| :|..|:.|..| :.|   |..|.|.||   ||.
  Rat    28 HESDSK-------------------NSENAS-SPAFVVHSNGV-EQPIGEQDRPEAKGE---GHE 68

  Fly   136 KLEDMIRELSGTLTSVKHEQEY-----MHVRDKIHRSVNENTNSRVVLWSTF---EALVLVLMTV 192
            :               :.|:|:     :|..|    ..||....:.:|.:.|   ..:|...|..
  Rat    69 E---------------QAEEEFLKFVILHAED----DTNEALRVQNLLQNDFGIRPGIVFAEMPC 114

  Fly   193 GQVY 196
            |:::
  Rat   115 GRLH 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 29/134 (22%)
Ticam2NP_001102360.1 TIR_2 <115..>169 CDD:419986 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.