DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and CG31787

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster


Alignment Length:222 Identity:52/222 - (23%)
Similarity:100/222 - (45%) Gaps:30/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAKVLLLVGSLLIL-CRTSHA------FIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGF--LD 60
            :|:|:.|:..||:| .:.|:|      ..|..:|..:|||::.:.......:.::||.||.  ..
  Fly     4 IARVIWLLQLLLLLDLKFSNAEPHNKQLTVFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETH 68

  Fly    61 VDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPG 125
            ::..:..|...::....|...||::..|...|:|..||:|..|:...|:|.|:::|      ||.
  Fly    69 INFNLMDPSRRLLIAETKRQMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEV------APA 127

  Fly   126 APGEEE---------------VGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSR 175
            ...|.|               |.:|.::..:.::...|...:..|:::...:...|:|.|:|.|.
  Fly   128 DREERELRDLRQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSM 192

  Fly   176 VVLWSTFEALVLVLMTVGQVYYLKRFF 202
            |..||..:.|.::.:...||..::..|
  Fly   193 VNKWSWAQFLSMIFVGFLQVLMVRSIF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 45/202 (22%)
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 44/196 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.