DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and p24-2

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001189205.1 Gene:p24-2 / 318890 FlyBaseID:FBgn0053105 Length:244 Species:Drosophila melanogaster


Alignment Length:199 Identity:50/199 - (25%)
Similarity:89/199 - (44%) Gaps:18/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LILC--RTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEV-----IDGGF------LDVDIKISG 67
            ||||  .::......:.....:||.|.|...|...|.::|     ...||      :.:.:::..
  Fly    10 LILCVLHSACGLYFHISQTERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRD 74

  Fly    68 PDNHVMHESEKESSGKYTFVAPAKGTYTVC-FNNERS--SMTPKLVMFSIDVGDAPQRAPGAPGE 129
            .|:.::......|.|:.:|.:...|.:.:| |:|..:  |.....|...|.||:..........:
  Fly    75 SDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDYAHVAQK 139

  Fly   130 EEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQ 194
            |::  |:|:..||:|...:..:..||.|...|::..|..:|:|||||:.||..:.:|||.|....
  Fly   140 EKL--TELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWH 202

  Fly   195 VYYL 198
            ::.|
  Fly   203 LFNL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 46/189 (24%)
p24-2NP_001189205.1 EMP24_GP25L 20..206 CDD:279450 45/187 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454814
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.