DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and Tmed1

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_006242706.1 Gene:Tmed1 / 315461 RGDID:1311679 Length:262 Species:Rattus norvegicus


Alignment Length:167 Identity:50/167 - (29%)
Similarity:78/167 - (46%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSID 115
            |.||.|..||||..:..|...::....:::.|.:|......|.|.:||:|..|:::.|||.|.: 
  Rat    95 FVVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEAGDYRLCFDNSFSTISEKLVFFEL- 158

  Fly   116 VGDAPQRAPGAPG------EEEVGHTKLEDMIRELSGTLTSVKHEQEYM------HVRDKIHRSV 168
            :.|:.|......|      .||:...|:||:...:....|.::...:.:      ..||   |::
  Rat   159 IFDSFQDEEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARD---RNL 220

  Fly   169 NENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVK 205
            .|:...||..||.....||:|:.|.||..|||||..|
  Rat   221 QEDNLERVNFWSAANVAVLLLVAVLQVCTLKRFFHDK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 48/163 (29%)
Tmed1XP_006242706.1 EMP24_GP25L 33..254 CDD:279450 47/162 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.