DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and Tmed5

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001007620.1 Gene:Tmed5 / 289883 RGDID:1359437 Length:229 Species:Rattus norvegicus


Alignment Length:191 Identity:52/191 - (27%)
Similarity:95/191 - (49%) Gaps:10/191 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAP 89
            |..::.|..:|||::.:.......:.::|:|||.||:|..::.|:...:...:::|.|.:| |..
  Rat    36 FTFTLPAGQKECFYQPMPLKASLEIEYQVLDGGELDIDFHLASPEGRTLVFEQRKSDGVHT-VET 99

  Fly    90 AKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPG------EEEVGHTKLEDM---IRELS 145
            ..|.|..||:|..|:::.|::.|.:.:.:..:...|...      ..:|...||||:   |..:.
  Rat   100 EDGDYMFCFDNTFSTISEKVIFFELILDNMGEEVEGQEDWKKYITNTDVLEMKLEDILESINSIK 164

  Fly   146 GTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVKR 206
            ..|:...|.|..:...:...|::.|:...||..||....:|:|:::..|||.||..||.||
  Rat   165 SRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSVVNLMVMVVVSAIQVYTLKSLFEDKR 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 48/186 (26%)
Tmed5NP_001007620.1 EMP24_GP25L 35..222 CDD:279450 48/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.