DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and C26C6.9

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001021011.1 Gene:C26C6.9 / 259317 WormBaseID:WBGene00007743 Length:217 Species:Caenorhabditis elegans


Alignment Length:218 Identity:34/218 - (15%)
Similarity:77/218 - (35%) Gaps:79/218 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IVSVDAHNE-ECFFENVEGGTKFGV----TFEVIDGGFLDVDIKISGP------------DNHVM 73
            |::.::.:: .|::|.:|.|....:    ||:.:    ..:..:::.|            |.|:.
 Worm    33 ILTFESESQLSCYYEPLETGMILNIGMRPTFDTV----YPMQFRVTSPSGDFSDWASGDGDAHME 93

  Fly    74 HESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVGHTKLE 138
            |.:.:            .|.|.:|....|.......:.|                   ....|:|
 Worm    94 HNTTE------------NGPYEICVYTRRPMKINLYLQF-------------------YNPEKME 127

  Fly   139 DMI----------RELSGTLTSVKHE--QEYMH--------VRDKIHRSVNEN--TNSRVVLWST 181
            :.:          :::..::.:..|.  :.|.|        |||:..:..|..  .|..:|.   
 Worm   128 NSLKTFFAHHQISKDIQNSIMASTHRIYKIYYHLKFYNQMVVRDEALQLQNSEFIQNYNIVF--- 189

  Fly   182 FEALVLVLMTVGQVYYLKRFFEV 204
              .:|.:::|:.||||:::.|.:
 Worm   190 --CIVAIIITISQVYYVRKLFRI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 33/215 (15%)
C26C6.9NP_001021011.1 EMP24_GP25L 34..209 CDD:366467 32/214 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.