DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and emp24

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_588020.1 Gene:emp24 / 2539350 PomBaseID:SPCC24B10.17 Length:199 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:70/204 - (34%)
Similarity:104/204 - (50%) Gaps:26/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILCRTSHAFIVSV--------DAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVM 73
            :||    |:.:||        ..|..|||:||:....:..||::...||...|.:.|..|...:|
pombe    10 VLC----AYFISVVFGHGITLKPHQRECFYENLRNNDQMSVTYQTNVGGDQLVSMSIYNPAGQIM 70

  Fly    74 HESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSID----VGDAPQRAPGAPGEEEVGH 134
            |:....|..:|:|.....|.|..||.|:......|.|:|::.    :.|          |:...:
pombe    71 HQEVPNSMAQYSFTVKNPGKYMYCFYNDALDGESKEVLFNVHGVIYISD----------EDLDAN 125

  Fly   135 TKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLK 199
            ..|...:|:|..|::.|||||||...|::|||:..|:||.||..||..:.::||.:.|.|::|||
pombe   126 NPLLGKVRQLHDTISKVKHEQEYFVARERIHRNTAESTNDRVKWWSILQTVILVSVCVFQIFYLK 190

  Fly   200 RFFEVKRVV 208
            |.|||||||
pombe   191 RLFEVKRVV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 61/190 (32%)
emp24NP_588020.1 EMP24_GP25L 21..194 CDD:279450 58/182 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 114 1.000 Domainoid score I1539
eggNOG 1 0.900 - - E1_KOG1692
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55991
Inparanoid 1 1.050 123 1.000 Inparanoid score I1479
OMA 1 1.010 - - QHG53803
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - otm47259
orthoMCL 1 0.900 - - OOG6_101558
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R395
SonicParanoid 1 1.000 - - X4219
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.