DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and Ticam2

DIOPT Version :10

Sequence 1:NP_572165.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_036017008.1 Gene:Ticam2 / 225471 MGIID:3040056 Length:251 Species:Mus musculus


Alignment Length:59 Identity:16/59 - (27%)
Similarity:24/59 - (40%) Gaps:17/59 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQ-RAPGAPGEEE 131
            |||:.::|.:    |..:|     |..:.|...|       ..|:..| .|.||..||:
Mouse    47 HESDSKNSEE----ACLRG-----FVEQSSGSEP-------PTGEQDQPEAKGAGPEEQ 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_572165.1 EMP24_GP25L 24..203 CDD:426051 16/59 (27%)
Ticam2XP_036017008.1 TIR_2 97..216 CDD:463954
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.