DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and TMED4

DIOPT Version :10

Sequence 1:NP_572165.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_872353.2 Gene:TMED4 / 222068 HGNCID:22301 Length:227 Species:Homo sapiens


Alignment Length:218 Identity:54/218 - (24%)
Similarity:101/218 - (46%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLILCRT-SHAFIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGF------------------LD 60
            ||.||.| :......:....:.||.|.:...|       ::.|.:                  |.
Human    19 LLALCATGAQGLYFHIGETEKRCFIEEIPDET-------MVIGNYRTQMWDKQKEVFLPSTPGLG 76

  Fly    61 VDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMT----PKL-VMFSIDVGDAP 120
            :.:::..||..|:...:..|.|::||.:...|.:.:|.::..:.|.    .|| |...|.||:..
Human    77 MHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHA 141

  Fly   121 QRAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEAL 185
            ...|....::::  |:|:...|:|...:..::.||:|...|::..|..:|:||.||:.||..:.:
Human   142 NNYPEIAAKDKL--TELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQRVLWWSIAQTV 204

  Fly   186 VLVLMTVGQVYYLKRFFEVKRVV 208
            :|:|..:.|:.:||.|||.|::|
Human   205 ILILTGIWQMRHLKSFFEAKKLV 227

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_572165.1 EMP24_GP25L 24..203 CDD:426051 45/201 (22%)
TMED4NP_872353.2 EMP24_GP25L 29..222 CDD:426051 45/201 (22%)
COPI vesicle coat-binding. /evidence=ECO:0000255 220..227 4/6 (67%)