DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and tmed-3

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_491892.1 Gene:tmed-3 / 172372 WormBaseID:WBGene00019003 Length:203 Species:Caenorhabditis elegans


Alignment Length:199 Identity:60/199 - (30%)
Similarity:101/199 - (50%) Gaps:5/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVGSLLILCRTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMH 74
            ::|.|:|:....|......:..:..:||:|:::........|:|:.||..|||:.|..|:..|::
 Worm     5 VIVSSILVALGLSIELTFELPDNANQCFYEDLKKDVDTVFEFQVVTGGHYDVDLIIEDPNGKVLY 69

  Fly    75 ESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVGH--TKL 137
            :..|:......|.|..:|||..||:||.|:.:.|:|......||  |.|..| ...:..|  |:|
 Worm    70 KDTKKQYDSINFKAEVEGTYKACFSNEFSTFSHKIVYMDWQFGD--QNALHA-AVTQGAHAMTQL 131

  Fly   138 EDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFF 202
            |:....:...|.::...|.:..:|:...|...|..|.||::||..::.|:|.:.:|||:.||.||
 Worm   132 ENYAVAIGDKLRTIDDYQTHHRLREATGRKRAEELNERVMIWSLGQSAVVVFIGIGQVFLLKSFF 196

  Fly   203 EVKR 206
            ..||
 Worm   197 NDKR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 53/180 (29%)
tmed-3NP_491892.1 EMP24_GP25L 19..197 CDD:366467 53/180 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1328081at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.