DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and TMED1

DIOPT Version :10

Sequence 1:NP_572165.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_006849.1 Gene:TMED1 / 11018 HGNCID:17291 Length:227 Species:Homo sapiens


Alignment Length:196 Identity:55/196 - (28%)
Similarity:91/196 - (46%) Gaps:16/196 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAP 89
            |...:.|..::||:::..........::||.|..||||..:..|...::....:::.|.:|....
Human    34 FTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPT 98

  Fly    90 AKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQRAPGAPG------EEEVGHTKLEDMIRELSGTL 148
            ..|.|.:||:|..|:::.|||.|.: :.|:.|......|      .||:...|:||:...:....
Human    99 EAGDYKLCFDNSFSTISEKLVFFEL-IFDSLQDDEEVEGWAEAVEPEEMLDVKMEDIKESIETMR 162

  Fly   149 TSVKHEQEYM------HVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVKRV 207
            |.::...:.:      ..||   |::.|....||..||.....||:|:.|.||..|||||:.||.
Human   163 TRLERSIQMLTLLRAFEARD---RNLQEGNLERVNFWSAVNVAVLLLVAVLQVCTLKRFFQDKRP 224

  Fly   208 V 208
            |
Human   225 V 225

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_572165.1 EMP24_GP25L 24..203 CDD:426051 51/189 (27%)
TMED1NP_006849.1 EMP24_GP25L 33..220 CDD:426051 51/189 (27%)
COPI vesicle coat-binding. /evidence=ECO:0000255 218..227 5/8 (63%)