DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHOp24 and TMED7-TICAM2

DIOPT Version :9

Sequence 1:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001157940.1 Gene:TMED7-TICAM2 / 100302736 HGNCID:33945 Length:404 Species:Homo sapiens


Alignment Length:151 Identity:54/151 - (35%)
Similarity:81/151 - (53%) Gaps:4/151 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCF 98
            ::||:|::..|||..:.|:||.||..|||.::..||..|:::..|:....:||.|...|||..||
Human    46 KQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCF 110

  Fly    99 NNERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVGH-TKLEDMIRELSGTLTSVKHEQEYMHVRD 162
            :||.|:.|.|.|.|...||:.|   |..|.|..|.. |::|.....:...|.||...|.:..:|:
Human   111 SNEFSTFTHKTVYFDFQVGEDP---PLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLRE 172

  Fly   163 KIHRSVNENTNSRVVLWSTFE 183
            ...||..|:.|:||..|.:.:
Human   173 AQGRSRAEDLNTRVAYWHSVD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 54/151 (36%)
TMED7-TICAM2NP_001157940.1 EMP24_GP25L 36..189 CDD:279450 53/145 (37%)
TIR_2 250..>341 CDD:304906
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1328081at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.